Overview

  • Product name
    Recombinant Human PDSS2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWN QVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTARG LVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSGIYSCQRSLAE ITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANAC NGLALLQNTKVVELLASALMDLVQGVYHENSTSKESYITDDIGISTWKEQ TFLSHGALLAKSCQAAMELAKHDAEVQNMAFQYGKHMAMSHKINSDVQPF IKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIREAQEKGRLDYAKLRE RIKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS
    • Amino acids
      1 to 399
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163484 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • All-trans-decaprenyl-diphosphate synthase subunit 2
    • bA59I9.3
    • C6orf210
    • Candidate tumor suppressor protein
    • chromosome 6 open reading frame 210
    • Decaprenyl pyrophosphate synthase subunit 2
    • decaprenyl pyrophosphate synthetase subunit 2
    • Decaprenyl-diphosphate synthase subunit 2
    • DLP1
    • DLP1_HUMAN
    • hDLP1
    • Pdss2
    • prenyl (decaprenyl) diphosphate synthase, subunit 2
    • subunit 2 of decaprenyl diphosphate synthase
    see all
  • Function
    Supplies decaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone-10.
  • Pathway
    Cofactor biosynthesis; ubiquinone biosynthesis.
  • Involvement in disease
    Defects in PDSS2 are a cause of coenzyme Q10 deficiency (COQ10D) [MIM:607426]. Coenzyme Q10 deficiency is an autosomal recessive disorder with variable manifestations. It can be associated with three main clinical phenotypes: a predominantly myopathic form with central nervous system involvement, an infantile encephalomyopathy with renal dysfunction and an ataxic form with cerebellar atrophy.
  • Sequence similarities
    Belongs to the FPP/GGPP synthase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab163484 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163484 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163484.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up