Recombinant Human PDXK.1 protein (ab101103)

Overview

  • Product nameRecombinant Human PDXK.1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO00764
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMEEECRVLSIQSHVIRGYVGNRAATF PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK YDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSM YVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLH SMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKV DAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKA QAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
    • Molecular weight38 kDa including tags
    • Amino acids1 to 312
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101103 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101103 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • pdxK
    • PDXK_HUMAN
    • PKH
    • PNK
    • Pyridoxal kinase
    • Pyridoxamine kinase
    • Pyridoxine kinase
    • Pyridoxine kinase;
    • Vitamin B6 kinase
    see all
  • FunctionRequired for synthesis of pyridoxal-5-phosphate from vitamin B6.
  • Tissue specificityUbiquitous. Isoform 3 is detected in adult testis and spermatozoa.
  • Sequence similaritiesBelongs to the pyridoxine kinase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human PDXK.1 protein images

  • 15% SDS-PAGE analysis of ab101103 (3µg)

References for Recombinant Human PDXK.1 protein (ab101103)

ab101103 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101103.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"