Recombinant Human PDXK.1 protein (ab101103)

Overview

  • Product name
    Recombinant Human PDXK.1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMEEECRVLSIQSHVIRGYVGNRAATF PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK YDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSM YVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLH SMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKV DAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKA QAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 312
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101103 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101103 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • pdxK
    • PDXK_HUMAN
    • PKH
    • PNK
    • Pyridoxal kinase
    • Pyridoxamine kinase
    • Pyridoxine kinase
    • Pyridoxine kinase;
    • Vitamin B6 kinase
    see all
  • Function
    Required for synthesis of pyridoxal-5-phosphate from vitamin B6.
  • Tissue specificity
    Ubiquitous. Isoform 3 is detected in adult testis and spermatozoa.
  • Sequence similarities
    Belongs to the pyridoxine kinase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab101103 (3µg)

References

ab101103 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101103.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up