Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ96GD0
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMARCERLRGAALRDVLGRAQGVLFDCDGVL WNGERAVPGAPELLERLARAGKAALFVSNNSRRARPELALRFARLGFGGL RAEQLFSSALCAARLLRQRLPGPPDAPGAVFVLGGEGLRAELRAAGLRLA GDPSAGDGAAPRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVATDRDP WHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSIDP ARTLMVGDRLETDILFGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLVP HYYVESIADLTEGLED
    • Molecular weight34 kDa including tags
    • Amino acids1 to 296
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab97953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity> 95 % SDS-PAGE.
    ab97953 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Chronophin
    • CIN
    • Pdxp
    • PLP
    • PLP phosphatase
    • PLPP
    • PLPP_HUMAN
    • Pyridoxal (pyridoxine, vitamin B6) phosphatase
    • Pyridoxal phosphate phosphatase
    • Rbp1
    • Reg I binding protein 1
    • RP1 37E16.5
    see all
  • FunctionProtein serine phosphatase that dephosphorylates 'Ser-3' in cofilin and probably also dephosphorylates phospho-serine residues in DSTN. Regulates cofilin-dependent actin cytoskeleton reorganization. Required for normal progress through mitosis and normal cytokinesis. Does not dephosphorylate phospho-threonines in LIMK1. Does not dephosphorylate peptides containing phospho-tyrosine. Pyridoxal phosphate phosphatase. Has some activity towards pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PMP) and pyridoxine 5'-phosphate (PNP), with a highest activity with PLP followed by PNP.
  • Tissue specificityUbiquitous. Highly expressed in all the regions of central nerve system except the spinal cord. Also expressed at high level in liver and testis. In fetus, it is weakly expressed in all organs except brain.
  • Sequence similaritiesBelongs to the HAD-like hydrolase superfamily.
  • Cellular localizationCytoplasm, cytosol. Cytoplasm, cytoskeleton. Cell projection, ruffle membrane. Cell projection, lamellipodium membrane. Cell membrane. Colocalizes with the actin cytoskeleton in membrane ruffles and lamellipodia. Diffusely distributed throughout the cytosol during pro-metaphase and metaphase. Detected at the dynamic cell poles during telophase. Detected at the cleavage furrow and contractile ring during cytokinesis. Transiently detected at the plasma membrane in late stages of cytokinesis. Detected at the midbody.
  • Information by UniProt

Recombinant Human PDXP protein images

  • 15% SDS-PAGE showing ab97953 at approximately 33.8kDa (3µg).

References for Recombinant Human PDXP protein (ab97953)

ab97953 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab97953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"