Overview

  • Product name
    Recombinant Human PDZD3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEKAADLQDTASLTLKFKFNPKLGIDNPVLSLAEDHDPYDPWSLERPRFC LLSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQGLQEGDRILAVNN DVVEHEDYAVVVRRIRASSPRVLLTVLARHAHDVARAQLGEDAHLCPTLG PGVRPRLCHIVKDEGGFGFSVTHGNQGPFWLVLSTGGAAERAGVPPGARL LEVNGLWQSGQQVTLLVAGPEVEEQCRQLGLPLAAPLAEGWALPTKPRCL HLEKGPQGFGFLLREEKGLDGRPGQFLWEVDPGLPAKKAGMQAGDRLVAV AGESVEGLGHEETVSRIQGQGSCVSLTVVDPEADRFFSMVRLSPLLFLEN TEAPASPQGSSSASLVETEDPSLEDTSVPSVPLGSRQCFLYPGPGGSYGF RLSCVASGPRLFISQVTPGGSAARAGLQVGDVILEVNGYPVGGQNDLERL QQLPEAEPPLCLKLAARSLRGLEAWIPPGAAEDWALASDLL
    • Amino acids
      1 to 491
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164137 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • IKEPP
    • Intestinal and kidney enriched PDZ protein
    • Intestinal and kidney-enriched PDZ protein
    • Na(+)/H(+) exchange regulatory cofactor NHE-RF4
    • Na/Pi cotransporter C terminal associated protein 2
    • Na/Pi cotransporter C-terminal-associated protein 2
    • NaPi-Cap2
    • Natrium-phosphate cotransporter IIa C-terminal-associated protein 2
    • NHERF-4
    • NHERF4
    • NHRF4_HUMAN
    • PDZ domain containing 2
    • PDZ domain containing 3
    • PDZ domain containing protein 2
    • PDZ domain-containing protein 2
    • PDZ domain-containing protein 3
    • PDZD 3
    • Pdzd3
    • PDZK2
    • Protein DLNB27
    • Sodium-hydrogen exchanger regulatory factor 4
    see all
  • Function
    Acts as a regulatory protein that associates with GUCY2C and negatively modulates its heat-stable enterotoxin-mediated activation. Stimulates SLC9A3 activity in the presence of elevated calcium ions.
  • Tissue specificity
    Expressed in kidney and the gastrointestinal tract. Not detected in brain, heart, skeletal muscle or cells of hematopoietic origin.
  • Sequence similarities
    Contains 4 PDZ (DHR) domains.
  • Cellular localization
    Cell membrane. Cytoplasm. Preferentially accumulates at the apical surface and ileal brush border of intestinal epithelial cells.
  • Information by UniProt

Images

  • ab164137 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164137 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164137.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up