Recombinant Human PDZRN4 protein (ab162285)

Overview

  • Product name
    Recombinant Human PDZRN4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGCNLCTFQKREEHYKLLYEVSQVNGKDLSKATHEEAVEAFRNAKEPIVV QVLRRTPLSRPAYGMASEVQLMNASTQTDITFEHIMALAKLRPPTPPVPD ICPFLLSDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRV SSQEKLGLTVCYRTDDEEDTGIYVSEVDPNSIAAKDGRIREGDRILQING EDVQNREEAVALLSNDECKRIVLLVARPEIQLDEGWLEDERNEFLEELNL EMLEEEHNEAMQPTANEVEQPKKQEEEEGTTDTATSSSNNHEKDSGVGRT DESLRNDESSEQENAAEDPNSTSLKSKRDLGQSQDTLGSVELQYNESLVS GEYIDSDCIGNPDEDCERFRQLLELKCKIRNHGEYDLYYSSSTIECNQGE QEGVEHELQLLNEELRNIELECQNIMQAHRLQKVTDQYGDIWTLHDGGFR NYNTSIDMQRGKLDDIMEHPEKSDKDSSSAYNTAESCRSTPLTVDRSPDS SLPRVINLTNKKNLRSTMAATQSSSGQSSKESTSTKAKTTEQGCSAESKE KVLEGSKLPDQEKAVSEHIPYLSPYHSSSYRYANIPAHARHYQSYMQLIQ QKSAVEYAQSQLSLVSMCKESQKCSEPKMEWKVKIRSDGTRYITKRPVRD RILKERALKIKEERSGMTTDDDTMSEMKMGRYWSKEERKQHLVRAKEQRR RREFMMRSRLECLKESPQSGSEGKKEINIIELSHKKMMKKRNKKILDNWM TIQELMTHGAKSPDGTRVHNAFLSVTTV
    • Amino acids
      1 to 778
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110017D07Rik
    • IMAGE5767589
    • KIAA3027
    • Ligand of Numb protein X 4
    • LNX 4
    • LNX4
    • mKIAA3027
    • PDZ domain containing ring finger 4
    • PDZ domain containing RING finger protein 4
    • PDZRN 4
    • SAMCAP3L
    • SEMACAP3 like protein
    • SEMCAP3L
    see all
  • Relevance
    PDZRN4 (PDZ domain-containing RING finger protein 4) contains two PDZ (DHR) domains and a RING-type zinc finger. Its function is unknown.

Images

  • ab162285 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162285 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162285.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up