Overview

  • Product nameRecombinant Human Pea3 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP43268
    • SpeciesHuman
    • SequenceMYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVAPEKFEGDIKQEGVG AFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEV ARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEAL FSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFG PKGGYSY
    • Molecular weight49 kDa including tags
    • Amino acids278 to 484

Specifications

Our Abpromise guarantee covers the use of ab114394 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114394 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Adenovirus E1A enhancer binding protein
    • Adenovirus E1A enhancer-binding protein
    • E1A F
    • E1A-F
    • ETS translocation variant 4
    • ets variant gene 4 (E1A enhancer binding protein E1AF)
    • ETV4
    • ETV4_HUMAN
    • PEA3
    • PEA3 protein
    • PEAS3
    • Polyomavirus enhancer activator 3
    • Polyomavirus enhancer activator 3 homolog
    • Protein PEA3
    see all
  • FunctionTranscriptional activator that binds to the enhancer of the adenovirus E1A gene; the core-binding sequence is 5'[AC]GGA[AT]GT-3'.
  • Sequence similaritiesBelongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Post-translational
    modifications
    Sumoylated; enhanced upon ERK/MAP kinase pathway activation, it positively regulates the transcriptional activator capacity. Sumoylation at Lys-96 probably requires phosphorylation at Ser-101. Transiently polysumoylated and desumoylated by SENP1. Sumoylation is a prerequisite to polyubiquitination which in turn increases proteasomal-mediated degradation. Probably polyubiquitinated by RNF4 and deubiquitinated by USP2.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Pea3 protein images

  • ab114394 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Pea3 protein (ab114394)

ab114394 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114394.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"