Overview

  • Product name
    Recombinant Human Pea3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVAPEKFEGDIKQEGVG AFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEV ARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEAL FSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFG PKGGYSY
    • Molecular weight
      49 kDa including tags
    • Amino acids
      278 to 484

Specifications

Our Abpromise guarantee covers the use of ab114394 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114394 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Adenovirus E1A enhancer binding protein
    • Adenovirus E1A enhancer-binding protein
    • E1A F
    • E1A-F
    • ETS translocation variant 4
    • ets variant gene 4 (E1A enhancer binding protein E1AF)
    • ETV4
    • ETV4_HUMAN
    • PEA3
    • PEA3 protein
    • PEAS3
    • Polyomavirus enhancer activator 3
    • Polyomavirus enhancer activator 3 homolog
    • Protein PEA3
    see all
  • Function
    Transcriptional activator that binds to the enhancer of the adenovirus E1A gene; the core-binding sequence is 5'[AC]GGA[AT]GT-3'.
  • Sequence similarities
    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Post-translational
    modifications
    Sumoylated; enhanced upon ERK/MAP kinase pathway activation, it positively regulates the transcriptional activator capacity. Sumoylation at Lys-96 probably requires phosphorylation at Ser-101. Transiently polysumoylated and desumoylated by SENP1. Sumoylation is a prerequisite to polyubiquitination which in turn increases proteasomal-mediated degradation. Probably polyubiquitinated by RNF4 and deubiquitinated by USP2.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114394 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114394 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114394.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up