Overview

  • Product name
    Recombinant Human PEBP4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGWTMRLVTAALLLGLMMVVTGDEDENSPCAHEALLDEDTLFCQGLEVFY PELGNIGCKVVPDCNNYRQKITSWMEPIVKFPGAVDGATYILVMVDPDAP SRAEPRQRFWRHWLVTDIKGADLKEGKIQGQELSAYQAPSPPAHSGFHRY QFFVYLQEGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNY QDSPTLQAPRGRASEPKHKTRRR
    • Amino acids
      1 to 223
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1700051A02Rik
    • 1700081D17Rik
    • AI429082
    • CORK 1
    • CORK1
    • Cousin of RKIP 1 protein
    • GWTM1933
    • hPEBP4
    • MGC22776
    • PEBP 4
    • Phosphatidylethanolamine binding protein 4
    • PRO4408
    • Protein cousin of RKIP 1
    • UNQ1933/PRO4408
    see all
  • Relevance
    PEBP4 appears to promote cellular resistance to TNF-induced apoptosis by inhibiting activation of the Raf-1/MEK/ERK pathway, JNK and phosphatidylethanolamine externalization.
  • Cellular localization
    Lysosome

Images

  • ab165687 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165687 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up