Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMNRTAMRASQKDFENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMP KPGVFDLINKAKWDAWNALGSLPKEAARQNYVDLVSSLSPSLESSSQVEP GTDRKSTGFETLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAAS KDDSIITVLTGNGDYYSSGNDLTNFTDIPPGGVEEKAKNNAVLLREFVGC FIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPE GCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEV WTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVLQGRWLSDEC TNAVVNFLSRKSKL

Specifications

Our Abpromise guarantee covers the use of ab88639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    purified by affinity chromatography
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • 2-trans-enoyl-CoA isomerase
    • ACBD2
    • acyl Coenzyme A binding domain containing 2
    • D2-enoyl-CoA isomerase
    • D3
    • D3 D2 enoyl CoA isomerase
    • DBI related protein 1
    • DBI-related protein 1
    • delta(2)-enoyl-CoA isomerase
    • Delta(3)
    • Delta(3) delta(2) enoyl CoA isomerase
    • Diazepam-binding inhibitor-related protein 1
    • Dodecenoyl CoA isomerase
    • Dodecenoyl-CoA isomerase
    • DRS 1
    • DRS-1
    • DRS1
    • Eci2
    • ECI2_HUMAN
    • Enoyl-CoA delta isomerase 2
    • HCA88
    • Hepatocellular carcinoma associated antigen 88
    • Hepatocellular carcinoma-associated antigen 88
    • mitochondrial
    • pECI
    • Peroxisomal 3
    • Peroxisomal 3,2-trans-enoyl-CoA isomerase
    • Peroxisomal D3 D2 enoyl CoA isomerase
    • Renal carcinoma antigen NY REN 1
    • Renal carcinoma antigen NY-REN-1
    see all
  • FunctionAble to isomerize both 3-cis and 3-trans double bonds into the 2-trans form in a range of enoyl-CoA species. Has a preference for 3-trans substrates.
  • Tissue specificityAbundant in heart, skeletal muscle and liver. Expressed in CD34(+) T-cells and CD34(+) bone marrow cells.
  • Sequence similaritiesIn the C-terminal section; belongs to the enoyl-CoA hydratase/isomerase family.
    Contains 1 ACB (acyl-CoA-binding) domain.
  • Cellular localizationMitochondrion and Peroxisome matrix.
  • Information by UniProt

References for Recombinant Human PECI protein (ab88639)

ab88639 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"