Overview

  • Product nameRecombinant Human PECR protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BY49
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMASWAKGRSYLAPGLLQGQVAIVTGG ATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIP IQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHA VLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARA GVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQ KIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPD HDNWPKGAGDLSVVKKMKETFKEKAKL
    • Molecular weight35 kDa including tags
    • Amino acids1 to 303
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113128 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 0.88% Sodium chloride, 10% Glycerol

General Info

  • Alternative names
    • 2
    • 2 4 dienoyl CoA reductase related protein
    • 4-dienoyl-CoA reductase-related protein
    • DCR RP
    • DCR-RP
    • DCRRP
    • HPDHase
    • HSA250303
    • OTTHUMP00000206786
    • PECR
    • PECR_HUMAN
    • Peroxisomal trans 2 enoyl CoA reductase
    • Peroxisomal trans-2-enoyl-CoA reductase
    • PRO1004
    • Putative short chain alcohol dehydrogenase
    • pVI ARL
    • pVI-ARL
    • PVIARL
    • SDR29C1
    • Short chain dehydrogenase/reductase family 29C member 1
    • TERP
    see all
  • FunctionParticipates in chain elongation of fatty acids. Has no 2,4-dienoyl-CoA reductase activity.
  • PathwayLipid metabolism; fatty acid biosynthesis.
  • Sequence similaritiesBelongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localizationPeroxisome.
  • Information by UniProt

Recombinant Human PECR protein images

  • 15% SDS-PAGE analysis of 3 µg ab113128.

References for Recombinant Human PECR protein (ab113128)

ab113128 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"