Overview

  • Product name
    Recombinant Human PECR protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMASWAKGRSYLAPGLLQGQVAIVTGG ATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIP IQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHA VLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARA GVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQ KIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPD HDNWPKGAGDLSVVKKMKETFKEKAKL
    • Molecular weight
      35 kDa including tags
    • Amino acids
      1 to 303
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab113128 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 0.88% Sodium chloride, 10% Glycerol

General Info

  • Alternative names
    • 2
    • 2 4 dienoyl CoA reductase related protein
    • 4-dienoyl-CoA reductase-related protein
    • DCR RP
    • DCR-RP
    • DCRRP
    • HPDHase
    • HSA250303
    • OTTHUMP00000206786
    • PECR
    • PECR_HUMAN
    • Peroxisomal trans 2 enoyl CoA reductase
    • Peroxisomal trans-2-enoyl-CoA reductase
    • PRO1004
    • Putative short chain alcohol dehydrogenase
    • pVI ARL
    • pVI-ARL
    • PVIARL
    • SDR29C1
    • Short chain dehydrogenase/reductase family 29C member 1
    • TERP
    see all
  • Function
    Participates in chain elongation of fatty acids. Has no 2,4-dienoyl-CoA reductase activity.
  • Pathway
    Lipid metabolism; fatty acid biosynthesis.
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization
    Peroxisome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab113128.

References

ab113128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up