Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRV RSSMSPTTNVLLSPLSVATALSASLGAEQRTESIIHRALYYDLISSPDIH GTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVL TGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVT KFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLT GSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLLS YEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAG TTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP
    • Molecular weight
      45 kDa
    • Amino acids
      20 to 418

Specifications

Our Abpromise guarantee covers the use of ab123832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab123832 is purified by proprietary chromatographic techniques.
  • Form
    Lyophilised
  • Additional notes
    Storage: Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time, but remains stable until the expiry date when stored at -20°C.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.40
    Constituents: 99% PBS, 0.88% Sodium chloride

  • Reconstitution
    Add deionized water to a working concentration of 0.5 mg/ml and let the lyophilized pellet dissolve completely.

General Info

  • Alternative names
    • Cell proliferation-inducing gene 35 protein
    • EPC 1
    • EPC-1
    • EPC1
    • OI12
    • OI6
    • PEDF
    • PEDF_HUMAN
    • PIG 35
    • PIG35
    • Pigment epithelium derived factor
    • Pigment epithelium-derived factor
    • Proliferation inducing protein 35
    • serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
    • Serpin F1
    • Serpin family F member 1
    • Serpin peptidase inhibitor clade F member 1
    • serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
    • SERPINF 1
    • Serpinf1
    see all
  • Function
    Neurotrophic protein; induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
  • Tissue specificity
    Retinal pigment epithelial cells and blood plasma.
  • Sequence similarities
    Belongs to the serpin family.
  • Developmental stage
    Expressed in quiescent cells.
  • Domain
    The N-terminal (AA 44-121) exhibits neurite outgrowth-inducing activity. The C-terminal exposed loop (AA 382-418) is essential for serpin activity.
  • Post-translational
    modifications
    The N-terminus is blocked. Extracellular phosphorylation enhances antiangiogenic activity.
    N- and O-glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.
  • Cellular localization
    Secreted. Melanosome. Enriched in stage I melanosomes.
  • Information by UniProt

References

ab123832 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up