Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP36955
    • SpeciesHuman
    • SequenceMQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRV RSSMSPTTNVLLSPLSVATALSASLGAEQRTESIIHRALYYDLISSPDIH GTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVL TGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVT KFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLT GSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLLS YEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAG TTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP
    • Molecular weight45 kDa
    • Amino acids20 to 418

Specifications

Our Abpromise guarantee covers the use of ab123832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab123832 is purified by proprietary chromatographic techniques.
  • FormLyophilised
  • Additional notesStorage: Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time, but remains stable until the expiry date when stored at -20°C.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.40
    Constituents: 99% PBS, 0.88% Sodium chloride

  • ReconstitutionAdd deionized water to a working concentration of 0.5 mg/ml and let the lyophilized pellet dissolve completely.

General Info

  • Alternative names
    • Cell proliferation-inducing gene 35 protein
    • EPC 1
    • EPC-1
    • EPC1
    • OI12
    • OI6
    • PEDF
    • PEDF_HUMAN
    • PIG 35
    • PIG35
    • Pigment epithelium derived factor
    • Pigment epithelium-derived factor
    • Proliferation inducing protein 35
    • serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
    • Serpin F1
    • Serpin family F member 1
    • Serpin peptidase inhibitor clade F member 1
    • serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
    • SERPINF 1
    • Serpinf1
    see all
  • FunctionNeurotrophic protein; induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
  • Tissue specificityRetinal pigment epithelial cells and blood plasma.
  • Sequence similaritiesBelongs to the serpin family.
  • Developmental stageExpressed in quiescent cells.
  • DomainThe N-terminal (AA 44-121) exhibits neurite outgrowth-inducing activity. The C-terminal exposed loop (AA 382-418) is essential for serpin activity.
  • Post-translational
    modifications
    The N-terminus is blocked. Extracellular phosphorylation enhances antiangiogenic activity.
    N- and O-glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.
  • Cellular localizationSecreted. Melanosome. Enriched in stage I melanosomes.
  • Information by UniProt

References for Recombinant Human PEDF protein (ab123832)

ab123832 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"