Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGG EETQRYCTDTGVLFRQESFFHWAFGVTEPGCYGVIDVDTGKSTLFVPRLP ASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVN TDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKI SSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENS AVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTAD QKAVYEAVLRSSRAVMGAMKPGVWW PDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDV HDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEAL ADPARASFFNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIE ACMAGCDKAFTPFSGPK
    • Molecular weight
      54 kDa
    • Amino acids
      2 to 493
    • Additional sequence information
      Mature protein

Specifications

Our Abpromise guarantee covers the use of ab185411 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab185411 is >95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as an 0.2 µM filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

General Info

  • Alternative names
    • Aminoacyl L proline hydrolase
    • Imidodipeptidase
    • MGC10905
    • MGC95081
    • Pep 4
    • Pep4
    • pepD
    • PEPD_HUMAN
    • Peptidase 4
    • Peptidase D
    • Prolidase
    • Proline dipeptidase
    • X pro dipeptidase
    • X-Pro dipeptidase
    • Xaa-Pro dipeptidase
    see all
  • Function
    Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. Plays an important role in collagen metabolism because the high level of iminoacids in collagen.
  • Involvement in disease
    Defects in PEPD are a cause of prolidase deficiency (PD) [MIM:170100]. Prolidase deficiency is an autosomal recessive disorder associated with iminodipeptiduria. The clinical phenotype includes skin ulcers, mental retardation, recurrent infections, and a characteristic facies. These features, however are incompletely penetrant and highly variable in both age of onset and severity. There is a tight linkage between the polymorphisms of prolidase and the myotonic dystrophy trait.
  • Sequence similarities
    Belongs to the peptidase M24B family. Eukaryotic-type prolidase subfamily.
  • Information by UniProt

References

ab185411 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185411.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up