Recombinant Human Peptide YY protein (ab114446)

Overview

  • Product name
    Recombinant Human Peptide YY protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYA SLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 97
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GHYY
    • MGC19143
    • Peptide tyrosine tyrosine
    • peptide YY
    • Peptide YY like
    • Peptide YY precursor
    • Peptide YY(3-36)
    • Prepro PYY
    • PYY
    • PYY 1
    • PYY II
    • PYY-I
    • PYY-II
    • PYY_HUMAN
    • PYY1
    • RATGHYY
    • Yy
    see all
  • Function
    This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
  • Sequence similarities
    Belongs to the NPY family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human Peptide YY protein images

  • ab114446 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Peptide YY protein (ab114446)

ab114446 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up