Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WRMIRQTPERILMTYQVPERVKEVVLKEDLEKLESMRQQQPQFSHGQKEE LAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDSC
    • Amino acids
      1105 to 1201
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160230 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2810049O06Rik
    • Cell growth inhibiting gene 13 protein
    • Cell growth-inhibiting gene 13 protein
    • Circadian clock protein PERIOD 3
    • GIG13
    • gPER3
    • Growth inhibiting protein 13
    • HGNC:8847
    • hPER3
    • mPer3
    • Per3
    • PER3_HUMAN
    • Period 3
    • Period circadian clock 3
    • Period circadian protein 3
    • Period circadian protein homolog 3
    • Period homolog 3
    • Period homolog 3 (Drosophila)
    • Period homolog 3, Drosophila
    • Period3
    see all
  • Function
    Component of the circadian clock mechanism which is essential for generating circadian rhythms. Can bind heme.
  • Sequence similarities
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Post-translational
    modifications
    Phosphorylation appears to require association with PER1 and translocation to the nucleus.
    Ubiquitinated.
  • Cellular localization
    Cytoplasm. Nucleus. Mainly cytoplasmic. Translocates to the nucleus through binding PER1, PER2, CRY1 or CRY2, but not TIMELESS.
  • Information by UniProt

Images

  • ab160230 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160230 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160230.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up