Recombinant Human Perilipin-1 protein (ab112340)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KIPALQYPPEKIASELKDTISTRLRSARNSISVPIASTSDKVLGAALAGC ELAWGVARDTAEFAANTRAGRLASGGADLALGSIEKVVEYLLPADKEESA PAPGHQQA
    • Molecular weight
      38 kDa including tags
    • Amino acids
      101 to 208
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112340 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Lipid droplet associated protein
    • Lipid droplet-associated protein
    • PERI
    • Perilipin
    • Perilipin A
    • Perilipin-1
    • PerilipinA
    • PLIN
    • PLIN1
    • PLIN1_HUMAN
    see all
  • Function
    Modulator of adipocyte lipid metabolism. Coats lipid storage droplets to protect them from breakdown by hormone-sensitive lipase (HSL). Its absence may result in leanness.
  • Tissue specificity
    Adipocytes.
  • Sequence similarities
    Belongs to the perilipin family.
  • Post-translational
    modifications
    Major cAMP-dependent protein kinase-substrate in adipocytes, also dephosphorylated by PP1. When phosphorylated, may be maximally sensitive to HSL and when unphosphorylated, may play a role in the inhibition of lipolysis, by acting as a barrier in lipid droplet.
  • Cellular localization
    Lipid droplet. Lipid droplet surface-associated.
  • Information by UniProt

Images

  • ab112340 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112340 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112340.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up