Recombinant Human Perilipin A protein (ab112340)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO60240
    • SpeciesHuman
    • SequenceKIPALQYPPEKIASELKDTISTRLRSARNSISVPIASTSDKVLGAALAGC ELAWGVARDTAEFAANTRAGRLASGGADLALGSIEKVVEYLLPADKEESA PAPGHQQA
    • Molecular weight38 kDa including tags
    • Amino acids101 to 208
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112340 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Lipid droplet associated protein
    • Lipid droplet-associated protein
    • PERI
    • Perilipin
    • Perilipin-1
    • PerilipinA
    • PLIN
    • PLIN1
    • PLIN1_HUMAN
    see all
  • FunctionModulator of adipocyte lipid metabolism. Coats lipid storage droplets to protect them from breakdown by hormone-sensitive lipase (HSL). Its absence may result in leanness.
  • Tissue specificityAdipocytes.
  • Sequence similaritiesBelongs to the perilipin family.
  • Post-translational
    modifications
    Major cAMP-dependent protein kinase-substrate in adipocytes, also dephosphorylated by PP1. When phosphorylated, may be maximally sensitive to HSL and when unphosphorylated, may play a role in the inhibition of lipolysis, by acting as a barrier in lipid droplet.
  • Cellular localizationLipid droplet. Lipid droplet surface-associated.
  • Information by UniProt

Recombinant Human Perilipin A protein images

  • ab112340 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Perilipin A protein (ab112340)

ab112340 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112340.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"