Recombinant Human Peripherin protein (ab114335)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSHHPSGLRAGFSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSAS PSSSVRLGSFRSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQE LQELNDRFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRE LRRELELLGRERDRVQVERDGLAEDLAALKQRLEEETRKREDAEHNLVLF RKDVDDATLSRLELERKIESLMDEIEFLKKLHEEELRDLQVSVESQQVQQ VEVEATVKPELTAALRDIRAQYESIAAKNLQEAEEWYKSKYADLSDAANR NHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALE AGGYQAGAARLEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLL EGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEV VTESQKEQRSELDKSSAHSY
    • Molecular weight
      78 kDa including tags
    • Amino acids
      1 to 470

Specifications

Our Abpromise guarantee covers the use of ab114335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NEF 4
    • NEF4
    • Neurofilament 4
    • Neurofilament 4 (57kD)
    • Perf
    • PERI_HUMAN
    • Peripherin
    • prph
    • PRPH 1
    • PRPH1
    see all
  • Function
    Class-III neuronal intermediate filament protein.
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Information by UniProt

Images

  • ab114335 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue

References

ab114335 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up