Recombinant Human Peripherin protein (ab114335)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP41219
    • SpeciesHuman
    • SequenceMSHHPSGLRAGFSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSAS PSSSVRLGSFRSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQE LQELNDRFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRE LRRELELLGRERDRVQVERDGLAEDLAALKQRLEEETRKREDAEHNLVLF RKDVDDATLSRLELERKIESLMDEIEFLKKLHEEELRDLQVSVESQQVQQ VEVEATVKPELTAALRDIRAQYESIAAKNLQEAEEWYKSKYADLSDAANR NHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALE AGGYQAGAARLEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLL EGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEV VTESQKEQRSELDKSSAHSY
    • Molecular weight78 kDa including tags
    • Amino acids1 to 470

Specifications

Our Abpromise guarantee covers the use of ab114335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NEF 4
    • NEF4
    • Neurofilament 4
    • Neurofilament 4 (57kD)
    • Perf
    • PERI_HUMAN
    • Peripherin
    • prph
    • PRPH 1
    • PRPH1
    see all
  • FunctionClass-III neuronal intermediate filament protein.
  • Sequence similaritiesBelongs to the intermediate filament family.
  • Information by UniProt

Recombinant Human Peripherin protein images

  • ab114335 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue

References for Recombinant Human Peripherin protein (ab114335)

ab114335 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"