Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQCLGRGGFGVVFEAKN KVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLEAP PEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFATKEHIEII APSPQRSRSFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQ DSCLTDCDVEDGTMDGNDEGHSFELCPSEASPYVRSRERTSSSIVFEDSG CDNASSKEEPKTNRLHIGNHCANKLTAFKPTSSKSSSEATLSISPPRPTT LSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWMNGRCTIEERERS VCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTAM DQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGL ILFELLYPFSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSP MERPEAINIIENAVFEDLDFPGKTVLRQRSRSLSSSGTKHSRQSNNSHSP LPSN
    • Molecular weight
      115 kDa including tags
    • Amino acids
      563 to 1115

Specifications

Our Abpromise guarantee covers the use of ab101115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    The specific activity of ab101115 was determined to be 18 nmol/min/mg by activity assay.
  • Applications

    Western blot

    SDS-PAGE

    Functional Studies

  • Purity
    > 90 % SDS-PAGE.
    The purity was determined to be >90% by densitometry
  • Form
    Liquid
  • Additional notes

    ab61428 (Human Smad3 full length protein) can be utilized as a substrate for assessing Kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 10mM Glutathione, 0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF, pH 7.5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • DKFZp781H1925
    • E2AK3_HUMAN
    • EC 2.7.11.1
    • Eif2ak3
    • Eukaryotic translation initiation factor 2 alpha kinase 3
    • Eukaryotic translation initiation factor 2-alpha kinase 3
    • Heme regulated EIF2 alpha kinase
    • HRI
    • HsPEK
    • Pancreatic eIF2 alpha kinase
    • Pancreatic eIF2-alpha kinase
    • PEK
    • PRKR like endoplasmic reticulum kinase
    • PRKR-like endoplasmic reticulum kinase
    • WRS
    see all
  • Function
    Phosphorylates the alpha subunit of eukaryotic translation-initiation factor 2 (EIF2), leading to its inactivation and thus to a rapid reduction of translational initiation and repression of global protein synthesis. Serves as a critical effector of unfolded protein response (UPR)-induced G1 growth arrest due to the loss of cyclin D1.
  • Tissue specificity
    Ubiquitous. A high level expression is seen in secretory tissues.
  • Involvement in disease
    Defects in EIF2AK3 are the cause of Wolcott-Rallison syndrome (WRS) [MIM:226980]; also known as multiple epiphyseal dysplasia with early-onset diabetes mellitus. WRS is a rare autosomal recessive disorder, characterized by permanent neonatal or early infancy insulin-dependent diabetes and, at a later age, epiphyseal dysplasia, osteoporosis, growth retardation and other multisystem manifestations, such as hepatic and renal dysfunctions, mental retardation and cardiovascular abnormalities.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. GCN2 subfamily.
    Contains 1 protein kinase domain.
  • Domain
    The lumenal domain senses perturbations in protein folding in the ER, probably through reversible interaction with HSPA5/BIP.
  • Post-translational
    modifications
    Autophosphorylated.
    N-glycosylated.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • The putity of ab101115 was determined to be 90% by densitometry.

    Approximate MWt: 115kDa
  • The specific activity of ab101115 was determined to be 18 nmol/min/mg by activity assay.

References

ab101115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up