Recombinant human Peroxiredoxin 2 protein (ab167977)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFV CPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLN IPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGR SVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
    • Molecular weight
      22 kDa
    • Amino acids
      1 to 198

Specifications

Our Abpromise guarantee covers the use of ab167977 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity: approximately 200-230 pmole/min/µg. Enzymatic activity was confirmed by measuring the remaining peroxide after incubation of PRDX2 and peroxide for 20 min at room temperature. Specific activity is defined as the amount of hydroperoxide that 1 µg of enzyme can reduce at 25°C for 1 minute.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Epididymis secretory sperm binding protein Li 2a
    • HEL S 2a
    • MGC4104
    • Natural killer cell enhancing factor B
    • Natural killer cell-enhancing factor B
    • Natural Killer Enhancing Factor B
    • NKEF B
    • NKEF-B
    • NKEFB
    • Peroxiredoxin-2
    • PRDX 2
    • PRDX2
    • PRDX2_HUMAN
    • PrP
    • PRX2
    • PRXII
    • PTX1
    • TDPX1
    • Thiol Specific Antioxidant 1
    • Thiol specific antioxidant protein
    • Thiol-specific antioxidant protein
    • Thioredoxin Dependent Peroxide Reductase 1
    • Thioredoxin peroxidase 1
    • Thioredoxin-dependent peroxide reductase 1
    • Torin
    • TPX1
    • TSA
    see all
  • Function
    Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).
  • Sequence similarities
    Belongs to the ahpC/TSA family.
    Contains 1 thioredoxin domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS PAGE of ab167977 (3µg).

References

ab167977 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167977.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up