Recombinant Human Peroxiredoxin 3 protein (ab173047)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTE IVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALL SDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEE TLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ
    • Molecular weight
      21 kDa
    • Amino acids
      63 to 256

Specifications

Our Abpromise guarantee covers the use of ab173047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituent: 0.24% Tris

General Info

  • Alternative names
    • Antioxidant protein 1
    • AOP 1
    • AOP-1
    • AOP1
    • HBC189
    • MER5
    • MGC104387
    • MGC24293
    • mitochondrial
    • peroxiredoxin 3
    • Peroxiredoxin III
    • Peroxiredoxin-3
    • PRDX3
    • PRDX3_HUMAN
    • PRO1748
    • Protein MER5 homolog
    • PRX III
    • Prx-III
    • PRX3
    • SP 22
    • SP-22
    • SP22
    • Thioredoxin dependent peroxide reductase mitochondrial
    • Thioredoxin-dependent peroxide reductase
    see all
  • Function
    Involved in redox regulation of the cell. Protects radical-sensitive enzymes from oxidative damage by a radical-generating system. Acts synergistically with MAP3K13 to regulate the activation of NF-kappa-B in the cytosol.
  • Sequence similarities
    Belongs to the ahpC/TSA family.
    Contains 1 thioredoxin domain.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

References

ab173047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up