Recombinant Human Peroxiredoxin 4 protein (ab172175)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEALPLLAATTPDHGRHRRLLLLPLLLFLL PAGAVQGWETEERPR TREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVID GEFKELKLTDYRGKY LVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWI NTPRRQGGLGPIRIP LLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSV DETLRLVQAFQYTDK HGEVCPAGWKPGSETIIPDPAGKLKYFDKLNLEHHHHHH
    • Molecular weight
      34 kDa including tags
    • Amino acids
      38 to 271
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172175 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.20
    Constituents: 0.88% Sodium chloride, 0.02% DTT, 99% Phosphate Buffer

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • Antioxidant enzyme 372
    • Antioxidant enzyme AOE372
    • AOE37 2
    • AOE37-2
    • AOE372
    • EC 1.11.1.15
    • Peroxiredoxin IV
    • Peroxiredoxin-4
    • Peroxiredoxin4
    • PRDX 4
    • Prdx4
    • PRDX4_HUMAN
    • PRX 4
    • Prx IV
    • Prx-IV
    • PRX4
    • PrxIV
    • Thioredoxin dependent peroxide reductase A0372
    • Thioredoxin peroxidase
    • Thioredoxin Peroxidase (Antioxidant Enzyme)
    • Thioredoxin peroxidase AO372
    • Thioredoxin-dependent peroxide reductase A0372
    • TRANK
    see all
  • Function
    Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.
  • Sequence similarities
    Belongs to the ahpC/TSA family.
    Contains 1 thioredoxin domain.
  • Cellular localization
    Cytoplasm. Secreted.
  • Information by UniProt

Images

  • SDS-PAGE gel showing ab172175 under non-reduced (Lane 1) and reduced (Lane 2) conditions.

References

ab172175 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172175.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up