Recombinant human Peroxiredoxin 6 protein (ab167982)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPGGLLLGDVAPNFEANTTVGRIRFHDFLG DSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHL AWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVT ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD WKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
    • Molecular weight
      27 kDa
    • Amino acids
      1 to 224
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity: approximately 95-120 pmole/min/µg. Enzymatic activity was confirmed by measuring the remaining peroxide after incubation of PRDX 6 and peroxide for 20 min at room temperature. Specific activity is defined as the amount of hydroperoxide that 1 µg of enzyme can reduce at 25°C for 1 minute.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 1 Cys
    • 1 Cys peroxiredoxin
    • 1 Cys PRX
    • 1 cysPrx
    • 1-Cys peroxiredoxin
    • 1-Cys PRX
    • 24 kDa protein
    • 9430088D19Rik
    • AA690119
    • Acidic calcium independent phospholipase A2
    • Acidic calcium-independent phospholipase A2
    • aiPLA2
    • Antioxidant protein 2
    • AOP2
    • Aop2 rs3
    • Brp 12
    • Ciliary body glutathione peroxidase
    • CP 3
    • EC 1.11.1.15
    • EC 1.11.1.7
    • EC 3.1.1.
    • Epididymis secretory sperm binding protein Li 128m
    • GPx
    • HEL S 128m
    • KIAA0106
    • Liver 2D page spot 40
    • Ltw4
    • Lvtw 4
    • MGC46173
    • mKIAA0106
    • Non selenium glutathione peroxidase
    • Non-selenium glutathione peroxidase
    • NSGPx
    • ORF06
    • OTTHUMP00000032693
    • p29
    • Peroxiredoxin-6
    • Peroxiredoxin6
    • PHGPx
    • Phospholipase A2 lysosomal
    • PLA2
    • PRDX 6
    • Prdx5
    • PRDX6
    • Prdx6 rs3
    • PRDX6_HUMAN
    • PRX
    • Red blood cells page spot 12
    • Thiol specific antioxidant protein
    see all
  • Function
    Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.
  • Sequence similarities
    Belongs to the ahpC/TSA family. Rehydrin subfamily.
    Contains 1 thioredoxin domain.
  • Cellular localization
    Cytoplasm. Lysosome. Cytoplasmic vesicle. Also found in lung secretory organelles.
  • Information by UniProt

Images

  • 15% SDS PAGE analysis of ab167982 at 3 µg.

References

ab167982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up