Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLW QFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDK LSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQPPPAHAHAAAAAAA AAAAAQDGALYKLPAGLAPLPFPGLSKLNLMAASAGVAPAGFSYWPGPGP AATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHYH
    • Amino acids
      1 to 238
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ETS-domain transcription factor
    • FEV
    • FEV (ETS oncogene family)
    • FEV ETS transcription factor
    • FEV_HUMAN
    • Fifth Ewing sarcoma variant
    • Fifth Ewing variant protein
    • HSRNAFEV
    • mPet1
    • PC12 ETS domain-containing transcription factor 1
    • PC12 ETS factor 1
    • Pet-1
    • Protein FEV
    see all
  • Function
    Functions as a transcriptional regulator. According to PubMed:12761502, it functions as a transcriptional repressor. Functions in the differentiation and the maintenance of the central serotonergic neurons. May play a role in cell growth.
  • Tissue specificity
    In brain, exclusively expressed in the major serotonergic neurons of the dorsal and median raphe nuclei located in the midbrain and pons. Also detected in prostate and small intestine.
  • Involvement in disease
    Genetic variation in FEV may be associated with susceptibility to sudden infant death syndrome (SIDS) [MIM:272120]. SIDS remains elusive in its causes and devastating in its consequences. Despite the impressive decline in the incidence of SIDS since the recommendation to avoid the prone sleep position, SIDS remains a leading cause of death in the first year of life.
    Note=A chromosomal aberration involving FEV is found in Ewing tumors. Translocation t(2;21;22)(q23;q22;q12) that forms a EWSR1-FEV fusion protein with a potential oncogenic activity.
  • Sequence similarities
    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162827 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162827 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up