Recombinant Human PET112L protein (ab159088)

Overview

  • Product name
    Recombinant Human PET112L protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQV VMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLS
    • Amino acids
      466 to 556
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • cytochrome c oxidase assembly factor PET112 homolog
    • Cytochrome oxidase assembly factor PET112 homolog
    • GATB_HUMAN
    • glu ADT subunit B
    • GLU-ADT subunit B
    • glutamyl tRNA Gln amidotransferase subunit B mitochondrial
    • glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
    • HSPC199
    • mitochondrial
    • PET112
    • PET112 homolog (yeast)
    • PET112-like
    • Probable glutamyl-tRNA(Gln) amidotransferase subunit B
    see all
  • Function
    Furnishes a means for formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
  • Tissue specificity
    Predominantly expressed in tissues characterized by high rates of oxidative phosphorylation (OxPhos), including muscle and heart.
  • Sequence similarities
    Belongs to the gatB/gatE family. GatB subfamily.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab159088 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up