Recombinant Human PEX11C protein (ab164927)

Overview

  • Product name
    Recombinant Human PEX11C protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCRTILRLFDDLA MFVYTKQYGLGAQEEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHV
    • Amino acids
      21 to 120
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC4281
    • Peroxin Pex11p gamma
    • Peroxin-11C
    • Peroxisomal biogenesis factor 11 gamma
    • Peroxisomal biogenesis factor 11C
    • Peroxisomal biogenesis factor 11G
    • Peroxisomal membrane protein 11C
    • PEX11-gamma
    • PEX11C
    • PEX11G
    • Pex11pgamma
    • Protein PEX11 homolog gamma
    • PX11C_HUMAN
    see all
  • Sequence similarities
    Belongs to the peroxin-11 family.
  • Cellular localization
    Peroxisome membrane.
  • Information by UniProt

Images

  • ab164927 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164927 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164927.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up