Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELV YSASNLLVLLNDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGA
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PBD8A
    • PBD8B
    • Peroxin 16
    • Peroxin16
    • Peroxisomal biogenesis factor 16
    • Peroxisomal membrane protein PEX16
    • PEX 16
    see all
  • Relevance
    PEX16 is required for peroxisome membrane biogenesis and may play a role in early stages of peroxisome assembly. It can recruit other peroxisomal proteins, such as PEX3 and PMP34, to de novo peroxisomes derived from the endoplasmic reticulum (ER). It may function as receptor for PEX3.
  • Cellular localization
    Peroxisome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane

Images

  • ab160475 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up