Overview

  • Product name
    Recombinant Human PEX3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSL PLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQ LEK
    • Amino acids
      271 to 373
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Peroxin-3
    • Peroxisomal assembly protein PEX3
    • Peroxisomal biogenesis factor 3
    • PEX3
    • PEX3_HUMAN
    • TRG18
    see all
  • Function
    Involved in peroxisome biosynthesis and integrity. Assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, is necessary for the import of peroxisomal membrane proteins in the peroxisomes.
  • Tissue specificity
    Found in all examined tissues.
  • Involvement in disease
    Peroxisome biogenesis disorder complementation group 12
    Peroxisome biogenesis disorder 10A
  • Sequence similarities
    Belongs to the peroxin-3 family.
  • Cellular localization
    Peroxisome membrane.
  • Information by UniProt

Images

  • ab160062 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160062 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up