Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAELIQKKLQGEVEKYQQLQKDLSKSMSGR QKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELGEARATVGKRL DYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAGAPGKA
    • Molecular weight
      17 kDa including tags
    • Amino acids
      1 to 129
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104644 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab104644 is purified the proteins by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • H2 KE2
    • H2KE2
    • HKE2
    • HLA class II region expressed gene KE2
    • KE 2
    • KE2
    • KE2 protein
    • KE2, mouse, homolog of
    • PFD6_HUMAN
    • Pfdn6
    • Prefoldin subunit 6
    • Protein Ke2
    see all
  • Function
    Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.
  • Sequence similarities
    Belongs to the prefoldin subunit beta family.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab104644 at approximately 16.7kDa (3µg).

References

ab104644 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104644.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up