Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO15212
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAELIQKKLQGEVEKYQQLQKDLSKSMSGR QKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELGEARATVGKRL DYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAGAPGKA
    • Molecular weight17 kDa including tags
    • Amino acids1 to 129
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104644 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab104644 is purified the proteins by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • H2 KE2
    • H2KE2
    • HKE2
    • HLA class II region expressed gene KE2
    • KE 2
    • KE2
    • KE2 protein
    • KE2, mouse, homolog of
    • PFD6_HUMAN
    • Pfdn6
    • Prefoldin subunit 6
    • Protein Ke2
    see all
  • FunctionBinds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.
  • Sequence similaritiesBelongs to the prefoldin subunit beta family.
  • Information by UniProt

Recombinant Human PFD6 protein images

  • 15% SDS-PAGE showing ab104644 at approximately 16.7kDa (3µg).

References for Recombinant Human PFD6 protein (ab104644)

ab104644 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104644.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"