Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      HHHHHHMAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKK KQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNL QEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES
    • Molecular weight
      15 kDa
    • Amino acids
      1 to 134
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
    Lyophilized from a 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Additional notes
    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • C1
    • PFD4
    • PFD4_HUMAN
    • PFDN4
    • Prefoldin 4
    • Prefoldin subunit 4
    • Protein C-1
    • Protein C1
    see all
  • Function
    Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.
  • Sequence similarities
    Belongs to the prefoldin subunit beta family.
  • Information by UniProt

References

ab153792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up