Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAQSINITELNLPQLEMLKNQLDQEVEFLS TSIAQLKVVQTKYVEAKD CLNVLNKSNEGKELLVPLTSSMYVPGKLHD VEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQE KHA MKQAVMEMMSQKIQQLTALGAAQATAKA
    • Molecular weight
      20 kDa including tags
    • Amino acids
      1 to 154
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113137 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113137 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 10% Glycerol

General Info

  • Alternative names
    • 1190001O17Rik
    • 1700010A06Rik
    • c myc binding protein
    • c-myc binding protein MM 1
    • C-myc-binding protein Mm-1
    • D15Ertd697e
    • EIG 1
    • Eig1
    • MGC5329
    • MGC71907
    • MM 1
    • MM1
    • Myc modulator 1
    • PFD5
    • PFD5_HUMAN
    • PFDN5
    • Prefoldin 5
    • Prefoldin subunit 5
    see all
  • Function
    Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.
  • Tissue specificity
    Highly expressed in pancreas and skeletal muscle and moderately in other tissues.
  • Sequence similarities
    Belongs to the prefoldin subunit alpha family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab113137.

References

ab113137 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113137.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up