Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ99471
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAQSINITELNLPQLEMLKNQLDQEVEFLS TSIAQLKVVQTKYVEAKD CLNVLNKSNEGKELLVPLTSSMYVPGKLHD VEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQE KHA MKQAVMEMMSQKIQQLTALGAAQATAKA
    • Molecular weight20 kDa including tags
    • Amino acids1 to 154
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113137 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113137 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 10% Glycerol

General Info

  • Alternative names
    • 1190001O17Rik
    • 1700010A06Rik
    • c myc binding protein
    • c-myc binding protein MM 1
    • C-myc-binding protein Mm-1
    • D15Ertd697e
    • EIG 1
    • Eig1
    • MGC5329
    • MGC71907
    • MM 1
    • MM1
    • Myc modulator 1
    • PFD5
    • PFD5_HUMAN
    • PFDN5
    • Prefoldin 5
    • Prefoldin subunit 5
    see all
  • FunctionBinds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.
  • Tissue specificityHighly expressed in pancreas and skeletal muscle and moderately in other tissues.
  • Sequence similaritiesBelongs to the prefoldin subunit alpha family.
  • Information by UniProt

Recombinant Human PFDN5 protein images

  • 15% SDS-PAGE analysis of 3 µg ab113137.

References for Recombinant Human PFDN5 protein (ab113137)

ab113137 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113137.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"