Recombinant Human PFKFB1 protein (ab114752)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP16118
    • SpeciesHuman
    • SequenceMSPEMGELTQTRLQKIWIPHSSGSSRLQRRRGSSIPQFTNSPTMVIMVGL PARGKTYISTKLTRYLNWIGTPTKVFNLGQYRREAVSYKNYEFFLPDNME ALQIRKQCALAALKDVHNYLSHEEGHVAVFDATNTTRERRSLILQFAKEH GYKVFFIESICNDPGIIAENIRQVKLGSPDYIDCDREKVLEDFLKRIECY EVNYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHIQSRTVYYLMNIHVT PRSIYLCRHGESELNIRGRIGGDSGLSVRGKQYAYALANFIQSQGISSLK VWTSRMKRTIQTAEALGVPYEQWKALNEIDAGVCEEMTYEEIQEHYPEEF ALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCL LAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCKVESIYLNVEAVNTHREK PENVDITREPEEALDTVPAHY
    • Molecular weight78 kDa including tags
    • Amino acids1 to 471

Specifications

Our Abpromise guarantee covers the use of ab114752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein. EC=3.1.3.46
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6 phosphofructo 2 kinase/fructose 2 6 biphosphatase 1
    • 6-bisphosphatase
    • 6-P2ase 1
    • 6-P2ASE liver isozyme
    • 6PF 2 K/Fru 2 6 P2ASE liver isozyme
    • 6PF 2 K/Fru 2,6 P2ase 1
    • 6PF-2-K/Fru-2
    • F261_HUMAN
    • F6PK
    • Fructose 2 6 bisphosphatase
    • Fructose 6 phosphate 2 kinase:fructose 2 6 bisphosphatase
    • Fructose-2
    • HL2K
    • MGC116715
    • MGC116717
    • PFK/FBPase 1
    • PFKFB 1
    • Pfkfb1
    • PFRX
    see all
  • FunctionSynthesis and degradation of fructose 2,6-bisphosphate.
  • Tissue specificityLiver.
  • Sequence similaritiesIn the C-terminal section; belongs to the phosphoglycerate mutase family.
  • Information by UniProt

Recombinant Human PFKFB1 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114752 at approximately 77.88kDa.

References for Recombinant Human PFKFB1 protein (ab114752)

ab114752 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"