Recombinant Human PFKFB4 protein (ab151909)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR GKTYISKKLT RYLNWIGVPTREFNVGQYRRDVVKTYKSFEFFLPDNEE GLKIRKQCALAALRDVRRFLSE EGGHVAVFDATNTTRERRATIFNFGE QNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIE CYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLMNIH VTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFAKSLAQFISDQNIKD LKVWTSQMKRTIQTAEALGVPYEQWKVLNEIDAGVCEEMTYEEIQDNYPL EFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMR CLLAYFLDKAAEQLPYLKCPLHTVLKLTPVAYGCKVESIFLNVAAVNTHR DRPQNVDISRPPEEALVTVPAHQ
    • Molecular weight
      82 kDa including tags
    • Amino acids
      2 to 469

Specifications

Our Abpromise guarantee covers the use of ab151909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Purity
    > 95 % Densitometry.

  • Form
    Liquid
  • Additional notes
    Also contains domain EC= 3.1.3.46
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.04% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names
    • 6-bisphosphatase
    • 6-P2ase 4
    • 6-P2ASE testis-type isozyme
    • 6-phosphofructo-2-kinase
    • 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4
    • 6PF 2 K/Fru 2,6 P2ase 4
    • 6PF 2 K/Fru 2,6 P2ase testis type isozyme
    • 6PF-2-K/Fru-2
    • 6PF-2-K/Fru-2,6-P2ase
    • Bifunctional enzyme with kinase and biphosphatase activities
    • F264_HUMAN
    • Fructose-2
    • Fructose-2,6-bisphosphatase
    • PFK/FBPase 4
    • PFKFB4
    see all
  • Function
    Synthesis and degradation of fructose 2,6-bisphosphate.
  • Sequence similarities
    In the C-terminal section; belongs to the phosphoglycerate mutase family.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab151909 which was determined to be >95% pure by densitometry.

References

ab151909 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up