Recombinant human PFTK1 (CDK14)/CyclinY protein (ab177576)

Overview

  • Product name
    Recombinant human PFTK1 (CDK14)/CyclinY protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDEICVTKMSTR NCQGMDSVIK PLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENN ACINFKTSSTGKESPKVRRHSS PSSPTSPKFGKADSYEKLEKLGEGSY ATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIR EASLLKGLKHANIV LLHDIIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQL LR GLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEV VTLWYRPP DVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQD QLERIFLVLGTPNEDTWPGV HSLPHFKPERFTLYSSKNLRQAWNKLSY VNHAEDLASKLLQCSPKNRLSAQAALSHEYFS DLPPRLWELTDMSSIF TVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH
    • Molecular weight
      72 kDa including tags
    • Amino acids
      1 to 469
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab177576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The specific activity of ab177576 was determined to be 2.5 nmol/min/mg

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 90 % Densitometry.

  • Form
    Liquid
  • Additional notes

    ab56270 (Human Rb protein fragment), ab89813 (Histone H1 protein) and ab64311 (Myelin Basic Protein protein) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

Images

  • The specific activity of ab177576 was determined to be 2.5 nmol/min/mg.

  • SDS-PAGE analysis of ab177576.

References

ab177576 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177576.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up