Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCG PESNKNHAQVVAQARLIVWNGP
    • Molecular weight
      34 kDa including tags
    • Amino acids
      268 to 339

Specifications

Our Abpromise guarantee covers the use of ab114952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • dJ417L20.2
    • PGK 2
    • pgk2
    • PGK2_HUMAN
    • PGKB
    • PGKPS
    • Phosphoglycerate kinase
    • Phosphoglycerate kinase 2
    • Phosphoglycerate kinase autosomal pseudogene
    • Phosphoglycerate kinase testis specific
    • testis specific
    see all
  • Tissue specificity
    Testis specific.
  • Pathway
    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 2/5.
  • Sequence similarities
    Belongs to the phosphoglycerate kinase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human PGK2 protein images

  • 12.5% SDS-PAGE showing ab114952 at approximately 33.55kDa.
    Stained with Coomassie Blue.

References for Recombinant Human PGK2 protein (ab114952)

ab114952 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up