Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP36871
    • SpeciesHuman
    • SequenceMVKIVTVKTQAYQDQKPGTSGLRKRVKVFQSSANYAENFIQSIISTVEPA QRQEATLVVGGDGRFYMKEAIQLIARIAAANGIGRLVIGQNGILSTPAVS CIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQI SKTIEEYAVCPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLR SIFDFSALKELLSGPNRLKIRIDAMHGVVGPYVKKILCEELGAPANSAVN CVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKH GFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVASATKI ALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLS ILATRKQSVEDILKDHWQKYGRNFFTRYDYEEVEAEGANKMMKDLEALMF DRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRI VFRLSGTGSAGATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQ ERTGRTAPTVIT
    • Molecular weight88 kDa including tags
    • Amino acids1 to 562

Specifications

Our Abpromise guarantee covers the use of ab114507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDG1T
    • Glucose phosphomutase 1
    • GSD14
    • OTTHUMP00000010519
    • OTTHUMP00000010520
    • PGM 1
    • PGM1
    • PGM1_HUMAN
    • Phosphoglucomutase 1
    • Phosphoglucomutase-1
    • Phosphoglucomutase1
    see all
  • FunctionThis enzyme participates in both the breakdown and synthesis of glucose.
  • Involvement in diseaseDefects in PGM1 are the cause of glycogen storage disease type 14 (GSD14) [MIM:612934]. A metabolic disorder resulting in a myopathy characterized by exercise-induced intolerance with episodes of rhabdomyolysis, normal elevation of lactate, and hyperammonemia on a forearm-exercise test.
  • Sequence similaritiesBelongs to the phosphohexose mutase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human PGM1 protein images

  • ab114507 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human PGM1 protein (ab114507)

ab114507 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114507.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"