Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVKIVTVKTQAYQDQKPGTSGLRKRVKVFQSSANYAENFIQSIISTVEPA QRQEATLVVGGDGRFYMKEAIQLIARIAAANGIGRLVIGQNGILSTPAVS CIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQI SKTIEEYAVCPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLR SIFDFSALKELLSGPNRLKIRIDAMHGVVGPYVKKILCEELGAPANSAVN CVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKH GFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVASATKI ALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLS ILATRKQSVEDILKDHWQKYGRNFFTRYDYEEVEAEGANKMMKDLEALMF DRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRI VFRLSGTGSAGATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQ ERTGRTAPTVIT
    • Molecular weight
      88 kDa including tags
    • Amino acids
      1 to 562

Specifications

Our Abpromise guarantee covers the use of ab114507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDG1T
    • Glucose phosphomutase 1
    • GSD14
    • OTTHUMP00000010519
    • OTTHUMP00000010520
    • PGM 1
    • PGM1
    • PGM1_HUMAN
    • Phosphoglucomutase 1
    • Phosphoglucomutase-1
    • Phosphoglucomutase1
    see all
  • Function
    This enzyme participates in both the breakdown and synthesis of glucose.
  • Involvement in disease
    Defects in PGM1 are the cause of glycogen storage disease type 14 (GSD14) [MIM:612934]. A metabolic disorder resulting in a myopathy characterized by exercise-induced intolerance with episodes of rhabdomyolysis, normal elevation of lactate, and hyperammonemia on a forearm-exercise test.
  • Sequence similarities
    Belongs to the phosphohexose mutase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab114507 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114507 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114507.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up