Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLI QNWPHYRSP
    • Amino acids
      138 to 196
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160284 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC126894
    • MGC126896
    • Peptidoglycan recognition protein
    • Peptidoglycan recognition protein 1
    • Peptidoglycan recognition protein short
    • PGLYRP
    • PGLYRP1
    • PGRP
    • PGRP S
    • PGRP-S
    • PGRP1_HUMAN
    • PHRP, short
    • SBBI68
    • TAG7
    • TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein)
    • TNFSF 3L
    • TNFSF3L
    • UNQ639/PRO1269
    see all
  • Function
    Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Binds also to Gram-negative bacteria, and has bacteriostatic activity towards Gram-negative bacteria. Plays a role in innate immunity.
  • Tissue specificity
    Highly expressed in bone marrow. Weak expression found in kidney, liver, small intestine, spleen, thymus, peripheral leukocyte, lung, fetal spleen and neutrophils.
  • Sequence similarities
    Belongs to the N-acetylmuramoyl-L-alanine amidase 2 family.
  • Post-translational
    modifications
    N-glycosylated. N-glycosylation is required for bactericidal activity.
  • Cellular localization
    Secreted. Cytoplasmic granule.
  • Information by UniProt

Images

  • ab160284 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160284 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160284.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up