Overview

  • Product name
    Recombinant Human PGS1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKGQIRVAKRRVVMASLYLGTGPLEQELVDCLESTLEKSLQAKFPSNLKV SILLDFTRGSRGRKNSRTMLLPLLRRFPEQVRVSLFHTPHLRGLLRLLIP ERFNETIGLQHIKVYLFDNSVILSGANLSDSYFTNRQDRYVFLQDCAEIA DFFTELVDAVGDVSLQLQGDDTVQVVDGMVHPYKGDRAEYCKAANKRVMD VINSARTRQQMLHAQTFHSNSLLTQEDAAAAGDRRPAPDTWIYPLIQMKP FEIQIDEIVTETLLTEAERGAKVYLTTGYFNLTQAYMDLVLGTRAEYQIL LASPEVNGFFGAKGVAGAIPAAYVHIERQFFSEVCSLGQQERVQLQEYWR RGWTFHAKGLWLYLAGSSLPCLTLIGSPNFGYRSVHRDLEAQIAIVTENQ ALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTPLIKNFF
    • Amino acids
      1 to 447
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160511 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDP diacylglycerol glycerol 3 phosphate 3 phosphatidyltransferase mitochondrial
    • CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
    • HCG1642326, isoform CRA_b
    • mitochondrial
    • PGP synthase 1
    • PGPS1_HUMAN
    • PGS1
    • PGS1 protein Fragment
    • Phosphatidylglycerophosphate synthase 1
    see all
  • Function
    Functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin.
  • Pathway
    Phospholipid metabolism; phosphatidylglycerol biosynthesis; phosphatidylglycerol from CDP-diacylglycerol: step 1/2.
  • Sequence similarities
    Belongs to the CDP-alcohol phosphatidyltransferase class-II family.
    Contains 2 PLD phosphodiesterase domains.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab160511 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160511 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160511.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up