Recombinant Human PHACTR3 protein (ab165101)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDQTPPARPEYLVSGIRTPPVRRNSKLATLGRIFKPWKWRKKKNEKLKQT TSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPT PKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDDAGQATLFQASSM KSADPSLRGQLSTPTGSPHLTTVHRPLPPSRVIEELHRALATKHRQDSFQ GRESKGSPKKRLDVRLSRTSSVERGKEREEAWSFDGALENKRTAAKESEE NKENLIINSELKDDLLLYQDEEALNDSIISGTLPRKCKKELLAVKLRNRP SKQELEDRNIFPRRTDEERQEIRQQIEMKLSKRLSQRPAVEELERRNILK QRNDQTEQEERREIKQRLTRKLNQRPTVDELRDRKILIRFSDYVEVAKAQ DYDRRADKPWTRLSAADKAAIRKELNEYKSNEMEVHASSKHLTRFHRP
    • Amino acids
      1 to 448
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165101 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C20orf101
    • H17739
    • MGC117178
    • PHACTR 3
    • Phactr3
    • PHAR3_HUMAN
    • Phosphatase and actin regulator 3
    • phosphatase and actin regulator 3, isoform 1
    • Scaffold associated PP1 inhibiting protein
    • Scaffold-associated PP1-inhibiting protein
    • SCAPIN 1
    • SCAPIN1
    • Scapinin
    see all
  • Tissue specificity
    Abundantly expressed in brain. Also found in several tumors such as lung carcinomas, nervous tumors and HL-60 leukemia cells. Isoform 3 is the major form in U937, GOTO and HL-60 leukemia cells.
  • Sequence similarities
    Belongs to the phosphatase and actin regulator family.
    Contains 4 RPEL repeats.
  • Cellular localization
    Nucleus matrix. Localized to the nuclear matrix-intermediate filament scaffold. Isoform 2 is also found in some cytoplasmic extensions.
  • Information by UniProt

Images

  • ab165101 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165101 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165101.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up