Recombinant Human PHD2 / prolyl hydroxylase protein (ab162793)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDG RCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFAD
    • Amino acids
      272 to 355
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C1ORF12
    • Chromosome 1 Open Reading Frame 12
    • DKFZp761F179
    • ECYT 3
    • ECYT3
    • Egl 9 family hypoxia inducible factor 1
    • EGL 9 homolog of C. elegans 1
    • EGL nine (C.elegans) homolog 1
    • Egl nine homolog 1
    • Egl nine homolog 1 (C. elegans)
    • Egl nine like protein 1
    • EGLN 1
    • Egln1
    • EGLN1_HUMAN
    • HIF PH2
    • HIF Prolyl Hydroxylase 2
    • HIF-PH2
    • HIF-prolyl hydroxylase 2
    • HIFP4H 2
    • HIFPH2
    • HPH 2
    • HPH-2
    • HPH2
    • Hypoxia inducible factor prolyl hydroxylase 2
    • Hypoxia-inducible factor prolyl hydroxylase 2
    • ORF13
    • P4H2
    • PHD 2
    • PhD2
    • PNAS 118
    • PNAS 137
    • Prolyl Hydroxylase Domain Containing Protein 2
    • Prolyl hydroxylase domain-containing protein 2
    • Rat Homolog of SM20
    • SM 20
    • SM-20
    • SM20
    • Zinc finger MYND domain containing protein 6
    • ZMYND6
    see all
  • Function
    Catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates HIF-1 alpha at 'Pro-402' and 'Pro-564', and HIF-2 alpha. Functions as a cellular oxygen sensor and, under normoxic conditions, targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex.
  • Tissue specificity
    According to PubMed:11056053, widely expressed with highest levels in skeletal muscle and heart, moderate levels in pancreas, brain (dopaminergic neurons of adult and fetal substantia nigra) and kidney, and lower levels in lung and liver. According to PubMed:12351678 widely expressed with highest levels in brain, kidney and adrenal gland. Expressed in cardiac myocytes, aortic endothelial cells and coronary artery smooth muscle.
  • Involvement in disease
    Defects in EGLN1 are the cause of erythrocytosis familial type 3 (ECYT3) [MIM:609820]. ECYT3 is an autosomal dominant disorder characterized by increased serum red blood cell mass, elevated serum hemoglobin and hematocrit, and normal serum erythropoietin levels.
  • Sequence similarities
    Contains 1 Fe2OG dioxygenase domain.
    Contains 1 MYND-type zinc finger.
  • Information by UniProt

Images

  • ab162793 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162793 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up