Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGPWSRVRVAKCQMLVTCFFILLLGLSVATMVTLTYFGAHFAVIRRASLE KNPYQAVHQWAFSAGLSLVGLLTLGAVLSAAATVREAQGLMAGGFLCFSL AFCAQVQVVFWRLHSPTQVEDAMLDTYDLVYEQAMKGTSHVRRQELAAIQ DVFLCCGKKSPFSRLGSTEADLCQGEEAAREDCLQGIRSFLRTHQQVASS LTSIGLALTLGPQGQIHPDPTSMWPPAPGAQPLEMLPGWTHTLSPLRSSC YWSKRMLG
    • Amino acids
      1 to 258
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ART1
    • FLJ17158
    • FLJ97586
    • MGC22455
    • Pan hematopoietic expression
    • PHEMX
    • PHMX
    • Tetraspanin
    • tetraspanin 32
    • tetraspanin32
    • TSPAN32
    • TSSC6
    • Tumor suppressing STF cDNA 6
    • Tumor suppressing subchromosomal transferable fragment cDNA 6
    • Tumor suppressing subtransferable candidate 6
    see all
  • Relevance
    PHEMX belongs to the conserved tetraspanin family of integral membrane proteins, which are thought to form multiprotein networks in the cell membrane in association with multiple protein partners. Tetraspanins have functional roles in cell motility, membrane fusion, proliferation, and adaptive immunity. This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. PHEMX may play a role in malignancies and disease that involve this region as well as hematopoietic cell function. There are 5 isoforms produced by alternative splicing.
  • Cellular localization
    Membrane; Multi-pass membrane protein

Images

  • ab160800 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160800 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up