Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO43189
    • SpeciesHuman
    • SequenceAQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTI KKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP
    • Molecular weight37 kDa including tags
    • Amino acids2 to 100

Specifications

Our Abpromise guarantee covers the use of ab114620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • hPCl1
    • MTF2 L2
    • MTF2L 2
    • MTF2L2
    • PCL 1
    • PCL1
    • PHD finger protein 1
    • PHD finger protein1
    • PHF 1
    • PHF 2
    • Phf1
    • PHF1_HUMAN
    • PHF2
    • Plc 1
    • Plc1
    • Polycomb like protein 1
    • Polycomb like protein1
    • Polycomb-like protein 1
    • Protein PHF1
    • T complex testis expressed 3
    • T complex testis expressed3
    • Tctex 3
    • Tctex3
    see all
  • FunctionTranscriptional repressor. May promote methylation of histone H3 on 'Lys-27' by the PRC2/EED-EZH2 complex.
  • Tissue specificityHighest levels in heart, skeletal muscle, and pancreas, lower levels in brain, placenta, lung, liver and kidney.
  • Sequence similaritiesContains 2 PHD-type zinc fingers.
  • Cellular localizationNucleus. Localizes specifically to the promoters of numerous target genes.
  • Information by UniProt

Recombinant Human PHF1 protein images

  • ab114620 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human PHF1 protein (ab114620)

ab114620 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114620.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"