Overview

  • Product name
    Recombinant Human PHF17 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRT DLITAMKLHDSYQLNPDEYYVLADPWRQEWEKGVQVPVSPGTIPQPVARV VSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCRYDLNDMDAAW LELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEY DEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTC ALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPI TKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMK TILAENDEVKFKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPF ASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVVDFL YQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQLFTHLRQDLE RVMIDTDTL
    • Amino acids
      1 to 509
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ22479
    • Gene for apoptosis and differentiation in epithelia
    • Jade family PHD finger 1
    • JADE1
    • JADE1_HUMAN
    • KIAA1807
    • OTTHUMP00000219842
    • OTTHUMP00000219934
    • OTTHUMP00000219935
    • OTTHUMP00000219936
    • PHD finger protein 17
    • PHD protein Jade 1
    • Phf17
    • Protein Jade 1
    • Protein Jade-1
    see all
  • Function
    Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Transcriptional coactivator it may also promote acetylation of nucleosomal histone H4 by KAT5. Promotes apoptosis. May act as a renal tumor suppressor.
  • Tissue specificity
    Highly expressed in kidney. Also present in pancreas, liver and heart (at protein level). Down-regulated in renal cancer cells.
  • Sequence similarities
    Belongs to the JADE family.
    Contains 2 PHD-type zinc fingers.
  • Domain
    The 2 PHD-type zinc fingers are required for transcriptional activity.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab164168 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164168 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164168.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up