Overview

  • Product name
    Recombinant Human PHF23 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLEAMAEPSPEDPPPTLKPETQPPEKRRRTIEDFNKFCSFVLAYAGYIPP SKEESDWPASGSSSPLRGESAADSDGWDSAPSDLRTIQTFVKKAKSSKRR AAQAGPTQPGPPRSTFSRLQAPDSATLLEKMKLKDSLFDLDGPKVASPLS PTSLTHTSRPPAALTPVPLSQGDLSHPPRKKDRKNRKLGPGAGAGFGVLR RPRPTPGDGEKRSRIKKSKKRKLKKAERGDRLPPPGPPQAPPSDTDSEEE EEEEEEEEEEEMATVVGGEAPVPVLPTPPEAPRPPATVHPEGVPPADSES KEVGSTETSQDGDASSSEGEMRVMDEDIMVESGDDSWDLITCYCRKPFAG RPMIECSLCGTWIHLSCAKIKKTNVPDFFYCQKCKELRPEARRLGGPPKS GEP
    • Amino acids
      1 to 403
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 410141M05Rik
    • FLJ16355
    • FLJ22884
    • hJUNE 1b
    • JUNE-1
    • MGC2941
    • P23-172M21.13-002
    • PDH containing protein JUNE 1
    • PDH-containing protein JUNE-1
    • PHD finger protein 23
    • PHD finger protein 23a
    • PHF23
    • PHF23_HUMAN
    • RP23-172M21.13
    see all
  • Involvement in disease
    Note=A chromosomal aberration involving PHF23 is found in a patient with acute myeloid leukemia (AML). Translocation t(11;17)(p15;p13) with NUP98.
  • Sequence similarities
    Belongs to the PHF23 family.
    Contains 1 PHD-type zinc finger.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • ab163987 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up