Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEG LIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPN GNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGI LGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLC DFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQ SGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIA VQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSP KGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEA GLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNG AVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLV SDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF
    • Amino acids
      1 to 533
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153270 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 PGDH
    • 3-PGDH
    • 3-phosphoglycerate dehydrogenase
    • 3PGDH
    • D-3-phosphoglycerate dehydrogenase
    • EC 1.1.1.95
    • Epididymis secretory protein Li 113
    • HEL S 113
    • NLS
    • NLS1
    • PDG
    • PGAD
    • PGD
    • PGDH
    • PGDH3
    • Phgdh
    • PHGDHD
    • Phosphoglycerate dehydrogenase
    • SERA
    • SERA_HUMAN
    see all
  • Pathway
    Amino-acid biosynthesis; L-serine biosynthesis; L-serine from 3-phospho-D-glycerate: step 1/3.
  • Involvement in disease
    Defects in PHGDH are the cause of phosphoglycerate dehydrogenase deficiency (PHGDH deficiency) [MIM:601815]. It is characterized by congenital microcephaly, psychomotor retardation, and seizures.
  • Sequence similarities
    Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.
  • Information by UniProt

Images

  • ab153270 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153270 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153270.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up