Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TLSKSSAVIEQGDCKNNALVPGTIQVNGHGGQPSKLVKRGPGRKPKVEVN TNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVHPIRDEVLPSSTCNFLSET NNVKEDL
    • Amino acids
      1599 to 1705
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DCAF14
    • DDB1 and CUL4 associated factor 14
    • FLJ20705
    • FLJ45918
    • IRS 1 PH domain binding protein
    • IRS1 PH domain binding protein
    • MGC90216
    • Ndrp
    • Neuronal differentiation related protein
    • PH interacting protein
    • Pleckstrin homology domain interacting protein
    • WD repeat containing protein 11
    • WD repeat protein 11
    • WDR11
    see all
  • Relevance
    PHIP contains two bromo domains and eight WD repeats. It may be involved in insulin signaling. It is expressed in myeloma and epidermoid carcinoma cell lines.

Images

  • ab162933 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up