Overview

  • Product name
    Recombinant Human PHKA1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DYDDNYDYLESGNWMNDYDSTSHARCGDEVARYLDHLLAHTAPHPKLAPT SQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPTKLFQASRPSF
    • Amino acids
      631 to 730
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5330411D17
    • 9830108K24Rik
    • kinase PHKA1
    • KPB1
    • KPB1_HUMAN
    • MGC132604
    • Pcyt1b
    • PHKA
    • PHKA1
    • Phosphorylase b kinase regulatory subunit alpha
    • Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
    • Phosphorylase kinase alpha M subunit
    • phosphorylase kinase, alpha 1 (muscle)
    • RP23 210E20.1
    • skeletal muscle isoform
    see all
  • Function
    Phosphorylase b kinase catalyzes the phosphorylation of serine in certain substrates, including troponin I. The alpha chain may bind calmodulin.
  • Tissue specificity
    Muscle specific. Isoform 1 is predominant in vastus lateralis muscle. Isoform 2 predominates slightly in heart, and it predominates clearly in the other tissues tested.
  • Pathway
    Glycan biosynthesis; glycogen metabolism.
  • Involvement in disease
    Glycogen storage disease 9D (GSD9D) [MIM:300559]: A metabolic disorder characterized by slowly progressive, predominantly distal muscle weakness and atrophy. Clinical features include exercise intolerance with early fatigability, pain, cramps and occasionally myoglobinuria. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities
    Belongs to the phosphorylase b kinase regulatory chain family.
  • Post-translational
    modifications
    Although the final Cys may be farnesylated, the terminal tripeptide is probably not removed, and the C-terminus is not methylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab159107 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159107 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up