Overview

Description

  • NatureRecombinant
  • SourceBaculovirus
  • Amino Acid Sequence
    • AccessionQ16816
    • SpeciesHuman
    • SequenceMTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKV IDVTGGGSFSPEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFF FLVFDLMKRGELFDYLTEKVTLSEKETRKIMRALLEVICTLHKLNIVHRD LKPENILLDDNMNIKLTDFGFSCQLEPGERLREVCGTPSYLAPEIIECSM NEDHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMSGNYQFG SPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFS PRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAY AFRIYGHWVKKGQQQNRAALFENTPKAVLLSLAEEDY
    • Molecular weight70 kDa including tags
    • Amino acids1 to 387

Associated products

Specifications

Our Abpromise guarantee covers the use of ab101715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThe specific activity of PHKG1 was determined to be 29 nmol/min/mg.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 75 % SDS-PAGE.

  • FormLiquid
  • Additional notes

    ab204885 (ZIP Kinase peptide substrate) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 10mM Glutathione, 0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF, pH 7.5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • PHK gamma M
    • PHK-gamma-M
    • Phkg
    • PHKG1
    • PHKG1_HUMAN
    • PHKIN01
    • Phosphorylase b kinase gamma catalytic chain
    • Phosphorylase b kinase gamma catalytic chain skeletal muscle/heart isoform
    • phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform
    • phosphorylase kinase gamma
    • phosphorylase kinase subunit gamma 1
    • Phosphorylase kinase subunit gamma-1
    • phosphorylase kinase, gamma 1 (muscle)
    • Phosphorylase kinase, muscle, gamma-1
    • Serine/threonine-protein kinase PHKG1
    • skeletal muscle/heart isoform
    see all
  • FunctionCatalytic subunit of the phosphorylase b kinase (PHK), which mediates the neural and hormonal regulation of glycogen breakdown (glycogenolysis) by phosphorylating and thereby activating glycogen phosphorylase. In vitro, phosphorylates PYGM, TNNI3, MAPT/TAU, GAP43 and NRGN/RC3.
  • Sequence similaritiesBelongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • DomainThe two calmodulin-binding domains appear to act in concert to bind a single molecule of calmodulin and are pseudosubstrate/autoinhibitory domains.
  • Information by UniProt

Recombinant human PHKG1 protein images

  • The putity of ab101715 was determined to be 75% by densitometry.

    Approximate MWt: 70kDa
  • The specific activity of ab101715 was determined to be 29 nmol/min/mg.

References for Recombinant human PHKG1 protein (ab101715)

ab101715 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"