Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKV IDVTGGGSFSPEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFF FLVFDLMKRGELFDYLTEKVTLSEKETRKIMRALLEVICTLHKLNIVHRD LKPENILLDDNMNIKLTDFGFSCQLEPGERLREVCGTPSYLAPEIIECSM NEDHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMSGNYQFG SPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFS PRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAY AFRIYGHWVKKGQQQNRAALFENTPKAVLLSLAEEDY
    • Molecular weight
      70 kDa including tags
    • Amino acids
      1 to 387

Associated products

Specifications

Our Abpromise guarantee covers the use of ab101715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    The specific activity of PHKG1 was determined to be 29 nmol/min/mg.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 75 % SDS-PAGE.

  • Form
    Liquid
  • Additional notes

    ab204885 (ZIP Kinase peptide substrate) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 10mM Glutathione, 0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF, pH 7.5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • PHK gamma M
    • PHK-gamma-M
    • Phkg
    • PHKG1
    • PHKG1_HUMAN
    • PHKIN01
    • Phosphorylase b kinase gamma catalytic chain
    • Phosphorylase b kinase gamma catalytic chain skeletal muscle/heart isoform
    • phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform
    • phosphorylase kinase gamma
    • phosphorylase kinase subunit gamma 1
    • Phosphorylase kinase subunit gamma-1
    • phosphorylase kinase, gamma 1 (muscle)
    • Phosphorylase kinase, muscle, gamma-1
    • Serine/threonine-protein kinase PHKG1
    • skeletal muscle/heart isoform
    see all
  • Function
    Catalytic subunit of the phosphorylase b kinase (PHK), which mediates the neural and hormonal regulation of glycogen breakdown (glycogenolysis) by phosphorylating and thereby activating glycogen phosphorylase. In vitro, phosphorylates PYGM, TNNI3, MAPT/TAU, GAP43 and NRGN/RC3.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Domain
    The two calmodulin-binding domains appear to act in concert to bind a single molecule of calmodulin and are pseudosubstrate/autoinhibitory domains.
  • Information by UniProt

Images

  • The putity of ab101715 was determined to be 75% by densitometry.

    Approximate MWt: 70kDa
  • The specific activity of ab101715 was determined to be 29 nmol/min/mg.

References

ab101715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up