Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEF AVKIMEVTAERLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESS
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159114 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GSD9C
    • PHK gamma LT
    • PHK gamma T
    • Phosphorylase b kinase gamma catalytic chain testis/liver isoform
    • Phosphorylase b kinase gamma catalytic chain, liver/testis isoform
    • Phosphorylase kinase catalytic subunit gamma 2
    • Phosphorylase kinase gamma subunit 2
    • Phosphorylase kinase subunit gamma 2
    • Phosphorylase kinase, gamma 2 (testis)
    • Phosphorylase kinase, gamma 2 (testis/liver)
    • PSK C3
    • Serine/threonine protein kinase PHKG2
    see all
  • Relevance
    Mutations in PHKG2 along with PHKA2 and PHKB, all three different genes of phosphorylase kinase (Phk) subunits, can give rise to glycogen storage disease of the liver. The autosomal-recessive, liver-specific variant of Phk deficiency is caused by mutations in the gene encoding the testis/liver isoform of the catalytic gamma subunit, PHKG2.
  • Cellular localization
    Cytoplasmic

Images

  • ab159114 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159114 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159114.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up