Recombinant Human PHLDA1 protein (ab153188)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLESSGCKALKEGVLEKRSDGLLQLWKKKCCILTEEGLLLIPPKQLQHQQ QQQQQQQQQQQQPGQGPAEPSQPSGPAVASLEPPVKLKELHFSNMKTVDC VERKGKYMY
    • Amino acids
      1 to 109
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Apoptosis associated nuclear protein
    • Apoptosis-associated nuclear protein
    • DT1P1B11
    • MGC131738
    • PHLA1_HUMAN
    • PHLDA1
    • PHRIP
    • Pleckstrin homology like domain family A member 1
    • Pleckstrin homology-like domain family A member 1
    • PQ rich protein
    • PQ-rich protein
    • PQR protein
    • Proline- and glutamine-rich protein
    • Proline- and histidine-rich protein
    • T cell death associated gene
    • T CELL DEATH ASSOCIATED GENE 51
    • T-cell death-associated gene 51 protein
    • Tdag
    • TDAG51
    see all
  • Function
    Seems to be involved in regulation of apoptosis. May be involved in detachment-mediated programmed cell death. May mediate apoptosis during neuronal development. May be involved in regulation of anti-apoptotic effects of IGF1. May be involved in translational regulation.
  • Tissue specificity
    Widely expressed with highest levels in pancreas. Strongly expressed by benign melanocytic nevi, and progressively reduced expressed in primary and metastatic melanomas (at protein level).
  • Sequence similarities
    Contains 1 PH domain.
  • Cellular localization
    Cytoplasm. Cytoplasmic vesicle. Nucleus, nucleolus. Colocalizes with intracellular vesicles.
  • Information by UniProt

Images

  • ab153188 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153188 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up