Recombinant Human Phosphatidic acid phosphatase type 2B protein (ab160113)

Overview

  • Product name
    Recombinant Human Phosphatidic acid phosphatase type 2B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLP FLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAI ITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVS IGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHA SFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHK HHPSDVLAGFAQGALVACCIVFFVSDLFKTKMTLSLPAPAIRKEILSPVD IIDRNNHHNMM
    • Amino acids
      1 to 311
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160113 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dri 42
    • Dri42
    • Lipid phosphate phosphohydrolase 3
    • LPP3
    • LPP3_HUMAN
    • PAP 2b
    • PAP-2b
    • PAP2 beta
    • PAP2-beta
    • PAP2b
    • Phosphatidate phosphohydrolase type 2b
    • Phosphatidic acid phosphatase 2b
    • Ppap2b
    • type 2 phosphatidic acid phosphatase beta
    • vascular endothelial growth factor and type I collagen inducible
    • Vascular endothelial growth factor and type I collagen inducible protein
    • Vascular endothelial growth factor and type I collagen-inducible protein
    • VCIP
    see all
  • Function
    Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). In addition it hydrolyzes lysophosphatidic acid (LPA), ceramide-1-phosphate (C-1-P) and sphingosine-1-phosphate (S-1-P). The relative catalytic efficiency is LPA = PA > C-1-P > S-1-P. May be involved in cell adhesion and in cell-cell interactions.
  • Tissue specificity
    Ubiquitously expressed. Highly expressed in heart and placenta.
  • Sequence similarities
    Belongs to the PA-phosphatase related phosphoesterase family.
  • Post-translational
    modifications
    N-glycosylated. Contains high-mannose oligosaccharides.
  • Cellular localization
    Golgi apparatus > trans-Golgi network membrane. Cell membrane.
  • Information by UniProt

Images

  • ab160113 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160113 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160113.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up