Recombinant Human Phosphatidylinositol 4 kinase III alpha protein (ab114905)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP42356
    • SpeciesHuman
    • SequenceVPEAIKFLVTWHTIDADAPELSHVLCWAPTDPPTGLSYFSSMYPPHPLTA QYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAASKSQLLAH QFIWNMKTNI
    • Molecular weight38 kDa
    • Amino acids338 to 447

Specifications

Our Abpromise guarantee covers the use of ab114905 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 2.7.1.67
    • Phosphatidylinositol 4 kinase alpha
    • Phosphatidylinositol 4 kinase catalytic alpha polypeptide
    • Phosphatidylinositol 4-kinase alpha
    • PI4 kinase
    • PI4-kinase alpha
    • PI4K ALPHA
    • PI4K-alpha
    • pi4K230
    • PI4KA
    • PI4KA_HUMAN
    • PIK4
    • PIK4CA
    • PtdIns 4 kinase
    • PtdIns-4-kinase alpha
    see all
  • FunctionActs on phosphatidylinositol (PtdIns) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate.
  • Tissue specificityExpressed ubiquitously. Highest levels in placenta and brain. Little or no expression in lung, liver, pancreas, testis or leukocytes.
  • Sequence similaritiesBelongs to the PI3/PI4-kinase family. Type III PI4K subfamily.
    Contains 1 PI3K/PI4K domain.
  • Information by UniProt

Recombinant Human Phosphatidylinositol 4 kinase III alpha protein images

  • 12.5% SDS-PAGE showing ab114905 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Phosphatidylinositol 4 kinase III alpha protein (ab114905)

ab114905 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114905.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"